PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H01407.1.p
Common NameEUGRSUZ_H01407
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 621aa    MW: 72153.4 Da    PI: 7.6246
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H01407.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR161.62.3e-1923106390
              FAR1   3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       Y  YA + GF vrk +  ++ ++g+it+rtfvC++eg++ +++++  +++ +r e r+gC a++k k + ++++ev++ ++eHnH++ 
  Eucgr.H01407.1.p  23 YVVYALSKGFGVRKGNLVRN-TKGKITRRTFVCNCEGYSVSSSDQ--EKKFERFEVRCGCLAHIKFKVD-TDVYEVIEYNSEHNHAFI 106
                       999**************999.7777**************999877..9999*****************9.9**************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.1E-1723106IPR004330FAR1 DNA binding domain
PfamPF105511.3E-28219313IPR018289MULE transposase domain
PROSITE profilePS509668.679498534IPR007527Zinc finger, SWIM-type
PfamPF044344.7E-5510531IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MEKDFEFAIG MVFSNEFEAY NKYVVYALSK GFGVRKGNLV RNTKGKITRR TFVCNCEGYS  60
VSSSDQEKKF ERFEVRCGCL AHIKFKVDTD VYEVIEYNSE HNHAFIPEDQ RHLIRCGKIM  120
SETCKGVLVD MMKGGIGGIS TYKCLANEAG GSKNLGLQRT RSNGISGEDC QDLLNHFHSM  180
EQQNPMFSYT LQVDQDGRLT NIFWRDGLSK FDYGCFGDVL VFDTIHHNDK CNMICAHFVG  240
VNHHWKNVLF GCAFLMDETV ESFIWLFEAF LKSMGNKAPK TMFTDQDQVM AKAIRMVFPN  300
TQHRLCTWHI MKNANQNIPH LYHKPEFKDK YFLALMYRCR SEDEFESTWR EMEERWDTKD  360
NIWLQKLYDL RHKWSLAFGR DIFTCGIRSS QRSESLNNVF QKIGSKTSTL VQFVYYYEKQ  420
VAHMREIESQ DDYSCRGTPK LMVSHDILKH AASVYTDAIF TRFNDEFLQS LSEIIVSSTF  480
DGLIYSYTLM CRGTQREHVV RFAPVDSSVF CECKLFESKG WLCRHALKVL IENISVTHIP  540
FAYVLKRWTK GAKQGIANDE FKQMSLDSSK SDRFSLLMQQ SFELMNLGAE DDNTMRIVRK  600
YMQKAKTEIS SYKSSVIVID D
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H01407.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010070164.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 9-like
TrEMBLA0A059AXR10.0A0A059AXR1_EUCGR; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-98FAR1-related sequence 5